Fasta - angsd
Annotation for de novo Assembled Seq. Contents 1 FASTA File Length Filter 2 Gene Prediction Choose GENSCAN or GeneMark.hmm 3 Gene Prediction to FASTA Converts GENSCAN or GeneMark.hmm output file to FASTA format 4 transcriptsToOrfs Trinity ...
Annotation for de novo Assembled Seq. Contents 1 FASTA File Length Filter 2 Gene Prediction Choose GENSCAN or GeneMark.hmm 3 Gene Prediction to FASTA Converts GENSCAN or GeneMark.hmm output file to FASTA format 4 transcriptsToOrfs Trinity ...
Biopython Tutorial and Cookbook
How to
FASTA_Reader_Component_Example_WF — NodePit
PDF) FilterByLength : Filter fasta sequences by length and count the sequences in a multifasta file
Usage - SeqKit - Ultrafast FASTA/Q kit
FASTA file of fixed length
Operations — SEDA 0.5 documentation
Querying data — BIGSdb 1.14.0 documentation
Manipulation on FASTA format file · Wei Shen's Note
Extract FASTA sequences based on sequence length using Perl — Bioinformatics Review
INPUT DATA In this section, the user must define the input for the prediction server following these steps: 1) Specify the desired type of input data (FASTA or PEPTIDE) using the drop down menu. 2) Provide the input data by means of pasting the data into the ...
PDF) FilterByLength : Filter fasta sequences by length and count the sequences in a multifasta file
1 Sequence formats >FOSB_MOUSE Protein fosB. 338 bp MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPAVDPYDMPGTSYSTPGLSAYSTGGASGS. - ppt download
Filter out Short Sequences - Unipro UGENE User Manual v. 34 - WIKI
Help pages for anvi'o programs and artifacts
OligoPicker Homepage
Extract FASTA sequences based on sequence length using Perl — Bioinformatics Review
Fasta Tools
GuideFinder workflow. Users set parameters and input FASTA files.... | Download Scientific Diagram
GitHub - clwgg/seqfilter: Filter fasta/fastq(.gz) files by ID and/or sequence length
